General Information

  • ID:  hor006668
  • Uniprot ID:  Q5W280(20-96)
  • Protein name:  Prokineticin Bo8
  • Gene name:  NA
  • Organism:  Bombina orientalis (Oriental fire-bellied toad)
  • Family:  AVIT (prokineticin) family
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVITGACDRDVQCGSGTCCAASAWSRNIRFCVPLGNSGEECHPASHKVPYDGKRLSSLCPCKSGLTCSKSGAKFQCS
  • Length:  77(20-96)
  • Propeptide:  MKCFAQIVVLLLVIAFSHGAVITGACDRDVQCGSGTCCAASAWSRNIRFCVPLGNSGEECHPASHKVPYDGKRLSSLCPCKSGLTCSKSGAKFQCS
  • Signal peptide:  MKCFAQIVVLLLVIAFSHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent agonist for both PKR1/PROKR1 and PKR2/PROKR2, and inducer of a potent and long-lasting hyperalgesia. Also potentiates capsaicin-induced TRPV1 current, when tested on DRG neurons. At subnanomolar concentrations, this protein both induces potent chem
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-19; 13-31; 18-59; 41-67; 61-76
  • Structure ID:  AF-Q5W280-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006668_AF2.pdbhor006668_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 935591 Formula: C332H533N103O107S10
Absent amino acids: M Common amino acids: SC
pI: 8.27 Basic residues: 11
Polar residues: 35 Hydrophobic residues: 20
Hydrophobicity: -18.05 Boman Index: -11918
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 54.55
Instability Index: 5086.88 Extinction Coefficient cystines: 7615
Absorbance 280nm: 100.2

Literature

  • PubMed ID:  15652643
  • Title:  Molecular cloning of mRNA from toad granular gland secretion and lyophilized skin: identification of Bo8--a novel prokineticin from Bombina orientalis.